Lineage for d3tuga_ (3tug A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437266Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily)
    consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation
  4. 1437267Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) (S)
    automatically mapped to Pfam PF00632
  5. 1437268Family d.148.1.1: Hect, E3 ligase catalytic domain [56205] (3 proteins)
  6. 1437280Protein automated matches [227072] (1 species)
    not a true protein
  7. 1437281Species Human (Homo sapiens) [TaxId:9606] [226230] (1 PDB entry)
  8. 1437282Domain d3tuga_: 3tug A: [217034]
    automated match to d1nd7a_
    complexed with cl, unx

Details for d3tuga_

PDB Entry: 3tug (more details), 2.27 Å

PDB Description: Crystal structure of the HECT domain of ITCH E3 ubiquitin ligase
PDB Compounds: (A:) E3 ubiquitin-protein ligase Itchy homolog

SCOPe Domain Sequences for d3tuga_:

Sequence, based on SEQRES records: (download)

>d3tuga_ d.148.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vrdfkakvqyfrfwcqqlampqhikitvtrktlfedsfqqimsfspqdlrrrlwvifpge
egldyggvarewffllshevsnpmyclfeyagkdnyclqinpasyinpdhlkyfrfigrf
iamalfhgkfidtgfslpfykrilnkpvglkdlesidpefynsliwvkennieecdlemy
fsvdkeilgeikshdlkpnggnilvteenkeeyirmvaewrlsrgveeqtqaffegfnei
lpqqylqyfdakelevllcgmqeidlndwqrhaiyrryartskqimwfwqfvkeidnekr
mrllqfvtgtcrlpvggfadlmgsngpqkfciekvgkenwlprshtcfnrldlppyksye
qlkekllfaieet

Sequence, based on observed residues (ATOM records): (download)

>d3tuga_ d.148.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vrdfkakvqyfrfwcqqlampqhikitvtrktlfedsfqqimsfspqdlrrrlwvifpge
egldyggvarewffllshevsnpmyclfeyayclqinpasyinpdhlkyfrfigrfiama
lfhgkfidtgfslpfykrilnkpvglkdlesidpefynsliwvkennyfskeeyirmvae
wrlsrgveeqtqaffegfneilpqqylqyfdakelevllcgmqeidlndwqrhaiyrrya
rtskqimwfwqfvkeidnekrmrllqfvtgtcrlpvggfadlmgsngpqkfciekvgken
wlprshtcfnrldlppyksyeqlkekllfaieet

SCOPe Domain Coordinates for d3tuga_:

Click to download the PDB-style file with coordinates for d3tuga_.
(The format of our PDB-style files is described here.)

Timeline for d3tuga_: