Lineage for d3tsre_ (3tsr E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1834683Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1834684Superfamily c.10.1: RNI-like [52047] (4 families) (S)
    regular structure consisting of similar repeats
  5. 1834685Family c.10.1.1: 28-residue LRR [52048] (3 proteins)
    this is a repeat family; one repeat unit is 1a4y A:207-235 found in domain
  6. 1834698Protein automated matches [190173] (3 species)
    not a true protein
  7. 1834709Species Mouse (Mus musculus) [TaxId:10090] [193512] (1 PDB entry)
  8. 1834710Domain d3tsre_: 3tsr E: [200876]
    Other proteins in same PDB: d3tsra_, d3tsrb_, d3tsrc_, d3tsrd_
    automated match to d3tsrg_
    complexed with edo, peg

Details for d3tsre_

PDB Entry: 3tsr (more details), 2.2 Å

PDB Description: x-ray structure of mouse ribonuclease inhibitor complexed with mouse ribonuclease 1
PDB Compounds: (E:) ribonuclease inhibitor

SCOPe Domain Sequences for d3tsre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tsre_ c.10.1.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mmsldiqceqlsdarwtellpliqqyevvrlddcgltevrckdissavqanpaltelslr
tnelgdggvglvlqglqnptckiqklslqncglteagcgilpgmlrslstlrelhlndnp
mgdaglkllceglqdpqcrleklqleycnltatsceplasvlrvkadfkelvlsnndlhe
pgvrilcqglkdsacqleslklencgitaanckdlcdvvaskaslqeldlssnklgnagi
aalcpglllpscklrtlwlwecditaegckdlcrvlrakqslkelslasnelkdegarll
cesllepgcqleslwiktcsltaascpyfcsvltksrsllelqmssnplgdegvqelcka
lsqpdtvlrelwlgdcdvtnsgcsslanvllanrslreldlsnncmggpgvlqlleslkq
psctlqqlvlydiywtneveeqlraleeerpslriis

SCOPe Domain Coordinates for d3tsre_:

Click to download the PDB-style file with coordinates for d3tsre_.
(The format of our PDB-style files is described here.)

Timeline for d3tsre_: