Lineage for d3trfb_ (3trf B:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.0: automated matches [191323] (1 protein)
not a true familyProtein automated matches [190123] (79 species)
not a true protein
Species Coxiella burnetii [TaxId:777] [196130] (3 PDB entries) 
Domain d3trfb_: 3trf B: [196136]
automated match to d1kaga_
complexed with so4
Details for d3trfb_
PDB Entry: 3trf (more details), 2.6 Å
PDB Description: structure of a shikimate kinase (arok) from coxiella burnetii
PDB Compounds: (B:) Shikimate kinaseSCOPe Domain Sequences for d3trfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3trfb_ c.37.1.0 (B:) automated matches {Coxiella burnetii [TaxId: 777]}
tniyliglmgagktsvgsqlakltkrilydsdkeiekrtgadiawifemegeagfrrrer
emiealckldniilatgggvvldeknrqqisetgvviyltasidtqlkrigqkgemrrpl
fiknnskeklqqlneirkplyqamadlvyptddlnprqlatqilvdik
SCOPe Domain Coordinates for d3trfb_:
Click to download the PDB-style file with coordinates for d3trfb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3trfb_:
- d3trfb_ first appeared in SCOPe 2.02
- d3trfb_ appears in SCOPe 2.03
- d3trfb_ appears in SCOPe 2.05
- d3trfb_ appears in the current release, SCOPe 2.08
View in 3D
