Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (64 species) not a true protein |
Species Coxiella burnetii [TaxId:777] [189725] (2 PDB entries) |
Domain d3tqsa_: 3tqs A: [185914] automated match to d1qyra_ |
PDB Entry: 3tqs (more details), 1.98 Å
SCOPe Domain Sequences for d3tqsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tqsa_ c.66.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]} qhflhdsfvlqkivsaihpqktdtlveigpgrgaltdylltecdnlalveidrdlvaflq kkynqqknitiyqndalqfdfssvktdkplrvvgnlpynistpllfhlfsqihciedmhf mlqkevvrritaevgshdygrlsvmaqyfcdntylftvspqaftppprvesaiirliprh nftpvaknldqlshvvkeafsyrrktvgnalkklinpsqwplleinpqlrpqeltvedfv kisniln
Timeline for d3tqsa_: