Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins) automatically mapped to Pfam PF00891 |
Protein automated matches [226979] (4 species) not a true protein |
Species Clarkia breweri [TaxId:36903] [226318] (5 PDB entries) |
Domain d3tkyd2: 3tky D:123-367 [216864] Other proteins in same PDB: d3tkya1, d3tkyb1, d3tkyc1, d3tkyd1 automated match to d1kyzc2 complexed with n7i, sah |
PDB Entry: 3tky (more details), 2.47 Å
SCOPe Domain Sequences for d3tkyd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tkyd2 c.66.1.12 (D:123-367) automated matches {Clarkia breweri [TaxId: 36903]} dgvslapflllatdkvllepwfylkdaileggipfnkaygmnifdyhgtdhrinkvfnkg mssnstitmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviqda pafsgvehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivaeyi lppspdpsiatkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafntyvm eflkt
Timeline for d3tkyd2: