Lineage for d3tjta1 (3tjt A:29-120)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690414Species Clostridium difficile [TaxId:272563] [226452] (4 PDB entries)
  8. 2690415Domain d3tjta1: 3tjt A:29-120 [216847]
    Other proteins in same PDB: d3tjta2
    automated match to d1unfx1
    complexed with fe

Details for d3tjta1

PDB Entry: 3tjt (more details), 1.8 Å

PDB Description: Crystal Structure Analysis of the superoxide dismutase from Clostridium difficile
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d3tjta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tjta1 a.2.11.0 (A:29-120) automated matches {Clostridium difficile [TaxId: 272563]}
nnkfkvkplpyaydalepyidketmklhhdkhyqayvdklnaalekypelynyslcellq
nldslpkdiattvrnnaggaynhkfffdimtp

SCOPe Domain Coordinates for d3tjta1:

Click to download the PDB-style file with coordinates for d3tjta1.
(The format of our PDB-style files is described here.)

Timeline for d3tjta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tjta2