Lineage for d3thua2 (3thu A:113-403)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2098969Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2099417Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2099418Protein automated matches [226923] (74 species)
    not a true protein
  7. 2099937Species Sphingomonas sp. [TaxId:314266] [267886] (1 PDB entry)
  8. 2099938Domain d3thua2: 3thu A:113-403 [265381]
    Other proteins in same PDB: d3thua1, d3thua3, d3thub1, d3thub3, d3thuc1, d3thuc3
    automated match to d4il2a2
    complexed with cl, gol, mg, unx

Details for d3thua2

PDB Entry: 3thu (more details), 1.8 Å

PDB Description: crystal structure of an enolase from sphingomonas sp. ska58 (efi target efi-501683) with bound mg
PDB Compounds: (A:) Mandelate racemase / muconate lactonizing enzyme family protein

SCOPe Domain Sequences for d3thua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3thua2 c.1.11.0 (A:113-403) automated matches {Sphingomonas sp. [TaxId: 314266]}
asregvmvyghangttiedtvkvaldyqaqgykairlqcgvpgmastygvskdkyfyepa
dadlpteniwntskylrivpelfkaareslgwdvhllhdihhrltpieagrlgqdlepyr
pfwledatpaenqeafrlirqhttaplavgeifnsiwdakdliqnqlidyiratvvhagg
ithlrriaaladlyqirtgchgatdlspvcmaaalhfdlsvpnfgiqeymrhmpetdavf
phaytfadgmmhpgdqpglgvdidedlaagyeykraflpvnrledgtmfnw

SCOPe Domain Coordinates for d3thua2:

Click to download the PDB-style file with coordinates for d3thua2.
(The format of our PDB-style files is described here.)

Timeline for d3thua2: