Lineage for d3tefa_ (3tef A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1878032Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1878139Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 1878387Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 1878388Protein automated matches [190944] (28 species)
    not a true protein
  7. 1878494Species Vibrio cholerae [TaxId:666] [193580] (3 PDB entries)
  8. 1878496Domain d3tefa_: 3tef A: [193581]
    automated match to d2chub_

Details for d3tefa_

PDB Entry: 3tef (more details), 1.7 Å

PDB Description: Crystal Structure of the Periplasmic Catecholate-Siderophore Binding Protein VctP from Vibrio Cholerae
PDB Compounds: (A:) Iron(III) ABC transporter, periplasmic iron-compound-binding protein

SCOPe Domain Sequences for d3tefa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tefa_ c.92.2.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
etvtiehrlgkttleqkpqrvvvigvgaldaidsfgiepvavskfdgtpdylakyksdky
psagslfepdfetiytqkpdlivigprasksydelskiaptivfaaeadqgywestqqqw
rnlgkvfaiepaveakieqvdaqfksimqynqqhksdamlvmssggnlttfgansrfssv
ykdfgfsetvpvskesshgdlisfeyirehnpktllvvdrdkvvtkgetnirqtfendlv
kattayknghiayldvnawyiaisgvkateqmvadmkas

SCOPe Domain Coordinates for d3tefa_:

Click to download the PDB-style file with coordinates for d3tefa_.
(The format of our PDB-style files is described here.)

Timeline for d3tefa_: