Lineage for d3tb6b_ (3tb6 B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
parallel beta-sheet of 6 strands, order 213456Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) 
Similar in architecture to the superfamily II but partly differs in topology
Family c.93.1.0: automated matches [191439] (1 protein)
not a true familyProtein automated matches [190646] (77 species)
not a true protein
Species Bacillus subtilis [TaxId:1423] [226286] (2 PDB entries) 
Domain d3tb6b_: 3tb6 B: [216713]
automated match to d2nzug_
complexed with arb, gol
Details for d3tb6b_
PDB Entry: 3tb6 (more details), 2.21 Å
PDB Description: structure of the effector-binding domain of arabinose repressor arar from bacillus subtilis
PDB Compounds: (B:) Arabinose metabolism transcriptional repressorSCOPe Domain Sequences for d3tb6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tb6b_ c.93.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
ktigvlttyisdyifpsiirgiesylseqgysmlltstnnnpdnerrglenllsqhidgl
iveptksalqtpnigyylnlekngipfaminasyaelaapsftlddvkggmmaaehllsl
ghthmmgifkaddtqgvkrmngfiqahrerelfpspdmivtftteekeskllekvkatle
knskhmptailcyndeialkvidmlremdlkvpedmsivgyddshfaqisevkltsvkhp
ksvlgkaaakyvidclehkkpkqedvifepeliirqsarklne
SCOPe Domain Coordinates for d3tb6b_:
Click to download the PDB-style file with coordinates for d3tb6b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3tb6b_:
- d3tb6b_ first appeared in SCOPe 2.03
- d3tb6b_ appears in SCOPe 2.07
View in 3D
