Lineage for d3taya_ (3tay A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781626Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins)
    automatically mapped to Pfam PF00426
  6. 1781635Protein automated matches [190699] (2 species)
    not a true protein
  7. 1781636Species Porcine rotavirus [TaxId:31578] [189719] (3 PDB entries)
  8. 1781639Domain d3taya_: 3tay A: [192512]
    automated match to d2i2sa_
    complexed with ben, epe, mn0, mpd, na, so4

Details for d3taya_

PDB Entry: 3tay (more details), 1.85 Å

PDB Description: crystal structure of porcine rotavirus crw-8 vp8* in complex with n- glycolylneuraminic acid
PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d3taya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3taya_ b.29.1.14 (A:) automated matches {Porcine rotavirus [TaxId: 31578]}
gslldgpyqpttfnpptsywillaptvegvviqgtnnidrwlatiliepnvqttnriynl
fgqqvtlsventsqtqwkfidvskttptgnytqhgslfstpklyavmkfsgriytyngtt
pnattgyysttnydtvnmtsfcdfyiiprnqeekcteyinhgl

SCOPe Domain Coordinates for d3taya_:

Click to download the PDB-style file with coordinates for d3taya_.
(The format of our PDB-style files is described here.)

Timeline for d3taya_: