Lineage for d3t8xc2 (3t8x C:184-282)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1514356Protein CD1, alpha-3 domain [88615] (5 species)
  7. 1514371Species Human (Homo sapiens), CD1b [TaxId:9606] [88617] (6 PDB entries)
  8. 1514373Domain d3t8xc2: 3t8x C:184-282 [200777]
    Other proteins in same PDB: d3t8xa1, d3t8xb_, d3t8xc1, d3t8xd_
    automated match to d1gzqa1
    complexed with act, gol, so4, t8x, uli

Details for d3t8xc2

PDB Entry: 3t8x (more details), 1.9 Å

PDB Description: crystal structure of human cd1b in complex with synthetic antigenic diacylsulfoglycolipid sgl12 and endogenous spacer
PDB Compounds: (C:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d3t8xc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t8xc2 b.1.1.2 (C:184-282) CD1, alpha-3 domain {Human (Homo sapiens), CD1b [TaxId: 9606]}
qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw
ylratldvadgeaaglscrvkhsslegqdiilywrnpid

SCOPe Domain Coordinates for d3t8xc2:

Click to download the PDB-style file with coordinates for d3t8xc2.
(The format of our PDB-style files is described here.)

Timeline for d3t8xc2:

1514373
d3t8xc2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3t8xc1