Lineage for d3t7la_ (3t7l A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037862Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 3037863Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 3037962Family g.50.1.0: automated matches [191482] (1 protein)
    not a true family
  6. 3037963Protein automated matches [190772] (6 species)
    not a true protein
  7. 3037968Species Human (Homo sapiens) [TaxId:9606] [187998] (28 PDB entries)
  8. 3037969Domain d3t7la_: 3t7l A: [249832]
    automated match to d1hyja_
    complexed with edo, zn

Details for d3t7la_

PDB Entry: 3t7l (more details), 1.09 Å

PDB Description: Crystal structure of the FYVE domain of endofin (ZFYVE16) at 1.1A resolution
PDB Compounds: (A:) Zinc finger FYVE domain-containing protein 16

SCOPe Domain Sequences for d3t7la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t7la_ g.50.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvlgqkqptwvpdseapncmncqvkftftkrrhhcracgkvfcgvccnrkcklqylekea
rvcvvcyetiskaq

SCOPe Domain Coordinates for d3t7la_:

Click to download the PDB-style file with coordinates for d3t7la_.
(The format of our PDB-style files is described here.)

Timeline for d3t7la_: