Lineage for d3szha_ (3szh A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2806418Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 2806419Protein automated matches [190537] (10 species)
    not a true protein
  7. 2806471Species Shewanella denitrificans [TaxId:318161] [195517] (5 PDB entries)
  8. 2806472Domain d3szha_: 3szh A: [216615]
    Other proteins in same PDB: d3szhc2
    automated match to d3szig_

Details for d3szha_

PDB Entry: 3szh (more details), 1.07 Å

PDB Description: Crystal structure of apo shwanavidin (P1 form)
PDB Compounds: (A:) Avidin/streptavidin

SCOPe Domain Sequences for d3szha_:

Sequence, based on SEQRES records: (download)

>d3szha_ b.61.1.0 (A:) automated matches {Shewanella denitrificans [TaxId: 318161]}
qeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtaisfs
tkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqts

Sequence, based on observed residues (ATOM records): (download)

>d3szha_ b.61.1.0 (A:) automated matches {Shewanella denitrificans [TaxId: 318161]}
qeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtaisfs
tkwlnsvescnsitswsgfyingqgkistlwqlvvngssspsqilkgqdvfsqts

SCOPe Domain Coordinates for d3szha_:

Click to download the PDB-style file with coordinates for d3szha_.
(The format of our PDB-style files is described here.)

Timeline for d3szha_: