Lineage for d3swna_ (3swn A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123076Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1123077Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1123517Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 1123518Protein automated matches [190914] (4 species)
    not a true protein
  7. 1123527Species Schizosaccharomyces pombe [TaxId:284812] [189773] (3 PDB entries)
  8. 1123530Domain d3swna_: 3swn A: [185569]
    automated match to d2fwka1
    protein/RNA complex; complexed with zn

Details for d3swna_

PDB Entry: 3swn (more details), 2.5 Å

PDB Description: Structure of the LSm657 Complex: An Assembly Intermediate of the LSm1 7 and LSm2 8 Rings
PDB Compounds: (A:) U6 snRNA-associated Sm-like protein LSm5

SCOPe Domain Sequences for d3swna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3swna_ b.38.1.0 (A:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
tilplelidkcigsnlwvimkserefagtlvgfddyvnivlkdvteydtvtgvtekhsem
llngngmcmlipggkp

SCOPe Domain Coordinates for d3swna_:

Click to download the PDB-style file with coordinates for d3swna_.
(The format of our PDB-style files is described here.)

Timeline for d3swna_: