Lineage for d3sw1a_ (3sw1 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alphaSuperfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) 
alpha-beta(2)-alpha(2)-beta(3)
Family d.110.3.0: automated matches [191387] (1 protein)
not a true familyProtein automated matches [190492] (24 species)
not a true protein
Species Pseudomonas putida [TaxId:160488] [256090] (4 PDB entries) 
Domain d3sw1a_: 3sw1 A: [249585]
automated match to d1ew0a_
complexed with fmn
Details for d3sw1a_
PDB Entry: 3sw1 (more details), 2.63 Å
PDB Description: Structure of a full-length bacterial LOV protein
PDB Compounds: (A:) Sensory box proteinSCOPe Domain Sequences for d3sw1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sw1a_ d.110.3.0 (A:) automated matches {Pseudomonas putida [TaxId: 160488]}
minaqllqsmvdasndgivvaekegddtiliyvnaafeyltgysrdeilyqdcrflqgdd
rdqlgrarirkamaegrpcrevlrnyrkdgsafwnelsitpvksdfdqrtyfigiqkdvs
rqvelerelaelra
SCOPe Domain Coordinates for d3sw1a_:
Click to download the PDB-style file with coordinates for d3sw1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3sw1a_:
- d3sw1a_ first appeared in SCOPe 2.04
- d3sw1a_ appears in SCOPe 2.07
View in 3D
