Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (18 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (93 PDB entries) |
Domain d3stbb_: 3stb B: [233620] automated match to d1u0qa_ protein/RNA complex |
PDB Entry: 3stb (more details), 2.5 Å
SCOPe Domain Sequences for d3stbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3stbb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]} qvqlqesggglvqaggslrlscaasgrtlssyamgwfrqapgkerefvaainrsgstfya davkgrftisrdnakntvylqmnslkpedtaayycaadrfspvvpgpipvntvdswgqgt qvtvss
Timeline for d3stbb_: