Lineage for d3sjna2 (3sjn A:129-373)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1573508Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1573839Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1573840Protein automated matches [226923] (59 species)
    not a true protein
  7. 1574197Species Shewanella pealeana [TaxId:398579] [233539] (1 PDB entry)
  8. 1574198Domain d3sjna2: 3sjn A:129-373 [233540]
    Other proteins in same PDB: d3sjna1, d3sjnb1
    automated match to d2poza2
    complexed with gol, mg, unl

Details for d3sjna2

PDB Entry: 3sjn (more details), 1.9 Å

PDB Description: Crystal structure of enolase Spea_3858 (target EFI-500646) from Shewanella pealeana with magnesium bound
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3sjna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sjna2 c.1.11.0 (A:129-373) automated matches {Shewanella pealeana [TaxId: 398579]}
kyrdkircygtfipadkpednvaivqglkdqgfssikfgggvmgddpdtdyaivkavrea
agpemevqidlaskwhtcghsammakrleefnlnwieepvladslisyeklsrqvsqkia
ggeslttryefqefitksnadivqpditrcggitemkkiydiaqmngtqliphgfstgil
lhasvhflaaceqgtlmefsqsssplftslvknqlqfdngfvavsdapglgieldeelia
kyrvn

SCOPe Domain Coordinates for d3sjna2:

Click to download the PDB-style file with coordinates for d3sjna2.
(The format of our PDB-style files is described here.)

Timeline for d3sjna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3sjna1