Lineage for d3sjna1 (3sjn A:1-128)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1905229Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1905230Protein automated matches [226922] (83 species)
    not a true protein
  7. 1905816Species Shewanella pealeana [TaxId:398579] [233536] (1 PDB entry)
  8. 1905817Domain d3sjna1: 3sjn A:1-128 [233538]
    Other proteins in same PDB: d3sjna2, d3sjnb2
    automated match to d2poza1
    complexed with gol, mg, unl

Details for d3sjna1

PDB Entry: 3sjn (more details), 1.9 Å

PDB Description: Crystal structure of enolase Spea_3858 (target EFI-500646) from Shewanella pealeana with magnesium bound
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3sjna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sjna1 d.54.1.0 (A:1-128) automated matches {Shewanella pealeana [TaxId: 398579]}
vlkitdievlhlrvpamdadcewgedavivkvhtdkgivgvgeadssplvvqacieapqt
nfycnglkrlligenaleierlwnkmywgsnymgrrgagihaisaidialwdiagqfygv
pvhtllgg

SCOPe Domain Coordinates for d3sjna1:

Click to download the PDB-style file with coordinates for d3sjna1.
(The format of our PDB-style files is described here.)

Timeline for d3sjna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3sjna2