![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (83 species) not a true protein |
![]() | Species Shewanella pealeana [TaxId:398579] [233536] (1 PDB entry) |
![]() | Domain d3sjna1: 3sjn A:1-128 [233538] Other proteins in same PDB: d3sjna2, d3sjnb2 automated match to d2poza1 complexed with gol, mg, unl |
PDB Entry: 3sjn (more details), 1.9 Å
SCOPe Domain Sequences for d3sjna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sjna1 d.54.1.0 (A:1-128) automated matches {Shewanella pealeana [TaxId: 398579]} vlkitdievlhlrvpamdadcewgedavivkvhtdkgivgvgeadssplvvqacieapqt nfycnglkrlligenaleierlwnkmywgsnymgrrgagihaisaidialwdiagqfygv pvhtllgg
Timeline for d3sjna1: