Lineage for d3rs1b_ (3rs1 B:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily)
unusual foldSuperfamily d.169.1: C-type lectin-like [56436] (9 families) 
Family d.169.1.0: automated matches [191331] (1 protein)
not a true familyProtein automated matches [190159] (16 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [187331] (21 PDB entries) 
Domain d3rs1b_: 3rs1 B: [195442]
automated match to d3hupa_
complexed with cl
Details for d3rs1b_
PDB Entry: 3rs1 (more details), 1.94 Å
PDB Description: Mouse C-type lectin-related protein Clrg
PDB Compounds: (B:) C-type lectin domain family 2 member ISCOPe Domain Sequences for d3rs1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rs1b_ d.169.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mnktyaacsknwtgvgnkcfyfsgyprnwtfaqafcmaqeaqlarfdneeeliflkrfkg
dfdswiglhressehpwkwtnnteynnmnpilgvgryaylssdrisssrsyinrmwicsk
ln
SCOPe Domain Coordinates for d3rs1b_:
Click to download the PDB-style file with coordinates for d3rs1b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3rs1b_:
- d3rs1b_ first appeared in SCOPe 2.02
- d3rs1b_ appears in SCOPe 2.05
- d3rs1b_ appears in SCOPe 2.07
- d3rs1b_ appears in the current release, SCOPe 2.08
View in 3D
