Lineage for d3rrma1 (3rrm A:98-286)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128313Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225477] (12 PDB entries)
  8. 2128325Domain d3rrma1: 3rrm A:98-286 [200504]
    Other proteins in same PDB: d3rrmc1, d3rrmc2
    automated match to d1xtia1
    complexed with adp, ihp, mg

Details for d3rrma1

PDB Entry: 3rrm (more details), 2.9 Å

PDB Description: s. cerevisiae dbp5 l327v bound to nup159, gle1 h337r, ip6 and adp
PDB Compounds: (A:) ATP-dependent RNA helicase DBP5

SCOPe Domain Sequences for d3rrma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rrma1 c.37.1.0 (A:98-286) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
glapellkgiyamkfqkpskiqeralplllhnpprnmiaqsqsgtgktaafsltmltrvn
pedaspqaiclapsrelarqtlevvqemgkftkitsqlivpdsfeknkqinaqvivgtpg
tvldlmrrklmqlqkikifvldeadnmldqqglgdqcirvkrflpkdtqlvlfsatfada
vrqyakkiv

SCOPe Domain Coordinates for d3rrma1:

Click to download the PDB-style file with coordinates for d3rrma1.
(The format of our PDB-style files is described here.)

Timeline for d3rrma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rrma2