Lineage for d3rdkb_ (3rdk B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1820295Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1820296Protein automated matches [190075] (72 species)
    not a true protein
  7. 1820602Species Paenibacillus sp. [TaxId:324057] [193799] (3 PDB entries)
  8. 1820604Domain d3rdkb_: 3rdk B: [193800]
    automated match to d2uwfa_
    complexed with cl, gol, mg

Details for d3rdkb_

PDB Entry: 3rdk (more details), 1.49 Å

PDB Description: protein crystal structure of xylanase a1 of paenibacillus sp. jdr-2
PDB Compounds: (B:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3rdkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rdkb_ c.1.8.0 (B:) automated matches {Paenibacillus sp. [TaxId: 324057]}
maplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnftfta
adamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiqtvm
khfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevldenp
swniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintnpdn
vklslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhiarvt
fwgmddntswraennpllfdknlqakpayygvid

SCOPe Domain Coordinates for d3rdkb_:

Click to download the PDB-style file with coordinates for d3rdkb_.
(The format of our PDB-style files is described here.)

Timeline for d3rdkb_: