Lineage for d3r8xa2 (3r8x A:208-314)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794501Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
    barrel, open; n*=6, S*=10; greek-key
  4. 2794502Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) (S)
  5. 2794549Family b.46.1.0: automated matches [227262] (1 protein)
    not a true family
  6. 2794550Protein automated matches [227053] (7 species)
    not a true protein
  7. 2794574Species Yersinia pestis [TaxId:632] [226111] (1 PDB entry)
  8. 2794575Domain d3r8xa2: 3r8x A:208-314 [215666]
    Other proteins in same PDB: d3r8xa1, d3r8xa3
    automated match to d1fmta1
    protein/RNA complex; complexed with gol, met, moe, trs

Details for d3r8xa2

PDB Entry: 3r8x (more details), 2.26 Å

PDB Description: Crystal Structure of Methionyl-tRNA Formyltransferase from Yersinia pestis complexed with L-methionine
PDB Compounds: (A:) Methionyl-tRNA formyltransferase

SCOPe Domain Sequences for d3r8xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r8xa2 b.46.1.0 (A:208-314) automated matches {Yersinia pestis [TaxId: 632]}
lskeeakldwtlsatqlercirafnpwpvsyfivdeqpikvwqaqvlpagedaepgtiih
adkhgiqvatadgvlnitqlqpagkkamsaadllnsrrewfipgsql

SCOPe Domain Coordinates for d3r8xa2:

Click to download the PDB-style file with coordinates for d3r8xa2.
(The format of our PDB-style files is described here.)

Timeline for d3r8xa2: