Class b: All beta proteins [48724] (180 folds) |
Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily) barrel, open; n*=6, S*=10; greek-key |
Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) |
Family b.46.1.0: automated matches [227262] (1 protein) not a true family |
Protein automated matches [227053] (7 species) not a true protein |
Species Yersinia pestis [TaxId:632] [226111] (1 PDB entry) |
Domain d3r8xa2: 3r8x A:208-314 [215666] Other proteins in same PDB: d3r8xa1, d3r8xa3 automated match to d1fmta1 protein/RNA complex; complexed with gol, met, moe, trs |
PDB Entry: 3r8x (more details), 2.26 Å
SCOPe Domain Sequences for d3r8xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r8xa2 b.46.1.0 (A:208-314) automated matches {Yersinia pestis [TaxId: 632]} lskeeakldwtlsatqlercirafnpwpvsyfivdeqpikvwqaqvlpagedaepgtiih adkhgiqvatadgvlnitqlqpagkkamsaadllnsrrewfipgsql
Timeline for d3r8xa2: