Lineage for d3r66c1 (3r66 C:4-78)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178713Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2178714Protein automated matches [190233] (22 species)
    not a true protein
  7. 2178753Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries)
  8. 2178808Domain d3r66c1: 3r66 C:4-78 [233409]
    Other proteins in same PDB: d3r66a_, d3r66b_, d3r66c2, d3r66d2
    automated match to d1z2ma1

Details for d3r66c1

PDB Entry: 3r66 (more details), 2.3 Å

PDB Description: crystal structure of human isg15 in complex with ns1 n-terminal region from influenza virus b, northeast structural genomics consortium target ids hx6481, hr2873, and or2
PDB Compounds: (C:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d3r66c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r66c1 d.15.1.0 (C:4-78) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplasq
glgpgstvllvvdkc

SCOPe Domain Coordinates for d3r66c1:

Click to download the PDB-style file with coordinates for d3r66c1.
(The format of our PDB-style files is described here.)

Timeline for d3r66c1: