Lineage for d3r5ga_ (3r5g A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) 
common fold is elaborated with additional secondary structuresFamily d.58.29.0: automated matches [191671] (1 protein)
not a true familyProtein automated matches [191274] (13 species)
not a true protein
Species Pseudomonas aeruginosa [TaxId:287] [189865] (1 PDB entry) 
Domain d3r5ga_: 3r5g A: [184808]
automated match to d1wc1a_
complexed with gol
Details for d3r5ga_
PDB Entry: 3r5g (more details), 1.5 Å
PDB Description: Crystal structure of the adenylyl cyclase CyaB from P. aeruginosa
PDB Compounds: (A:) CyaBSCOPe Domain Sequences for d3r5ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r5ga_ d.58.29.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
etqrkkltvffsdirgftelseeleaealtdllnnylnemskialkyggtidkfvgdcvm
vffgdpstqgakkdavaavsmgiamrkhmkvlrqqwraqgitkpleirmgintgyctvgn
fgadtrmdytiigrevnlasrlesaseageilishetyslikdvimcrdkgqiavkgfsr
pvqiyqvvdsrrdlg
SCOPe Domain Coordinates for d3r5ga_:
Click to download the PDB-style file with coordinates for d3r5ga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3r5ga_:
- d3r5ga_ first appeared in SCOPe 2.01
- d3r5ga_ appears in SCOPe 2.07
View in 3D
