Lineage for d3r3ra_ (3r3r A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1806519Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1806520Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 1806799Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 1806800Protein automated matches [190967] (28 species)
    not a true protein
  7. 1806944Species Salmonella typhimurium [TaxId:90371] [189687] (1 PDB entry)
  8. 1806945Domain d3r3ra_: 3r3r A: [184795]
    automated match to d1xhda_
    complexed with zn

Details for d3r3ra_

PDB Entry: 3r3r (more details), 1.2 Å

PDB Description: Structure of the YrdA ferripyochelin binding protein from Salmonella enterica
PDB Compounds: (A:) ferripyochelin binding protein

SCOPe Domain Sequences for d3r3ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r3ra_ b.81.1.0 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
snamsdtlrpyknlfpgigqrvmidtssvvigdvrladdvgiwplvvirgdvnyvaigar
tniqdgsvlhvthksssnphgnpliigedvtvghkvmlhgctignrvlvgmgsivldgai
ieddvmigagslvpqhkrlesgylylgspvkqirplsdaersglqysannyvkwkddyls
qdnh

SCOPe Domain Coordinates for d3r3ra_:

Click to download the PDB-style file with coordinates for d3r3ra_.
(The format of our PDB-style files is described here.)

Timeline for d3r3ra_: