Class b: All beta proteins [48724] (176 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
Protein automated matches [190967] (28 species) not a true protein |
Species Salmonella typhimurium [TaxId:90371] [189687] (1 PDB entry) |
Domain d3r3ra_: 3r3r A: [184795] automated match to d1xhda_ complexed with zn |
PDB Entry: 3r3r (more details), 1.2 Å
SCOPe Domain Sequences for d3r3ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r3ra_ b.81.1.0 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]} snamsdtlrpyknlfpgigqrvmidtssvvigdvrladdvgiwplvvirgdvnyvaigar tniqdgsvlhvthksssnphgnpliigedvtvghkvmlhgctignrvlvgmgsivldgai ieddvmigagslvpqhkrlesgylylgspvkqirplsdaersglqysannyvkwkddyls qdnh
Timeline for d3r3ra_: