Lineage for d3r03b_ (3r03 B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.113: Nudix [55810] (1 superfamily)
beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
contains beta-grasp motifSuperfamily d.113.1: Nudix [55811] (8 families) 
Family d.113.1.0: automated matches [191580] (1 protein)
not a true familyProtein automated matches [191036] (17 species)
not a true protein
Species Rhodospirillum rubrum [TaxId:269796] [189854] (1 PDB entry) 
Domain d3r03b_: 3r03 B: [184752]
automated match to d1muta_
complexed with adp
Details for d3r03b_
PDB Entry: 3r03 (more details), 2.49 Å
PDB Description: the crystal structure of nudix hydrolase from rhodospirillum rubrum
PDB Compounds: (B:) NUDIX hydrolaseSCOPe Domain Sequences for d3r03b_:
Sequence, based on SEQRES records: (download)
>d3r03b_ d.113.1.0 (B:) automated matches {Rhodospirillum rubrum [TaxId: 269796]}
lglpillvtaaalidpdgrvllaqrppgkslaglwefpggklepgetpeaalvrelaeel
gvdtrasclaplafashsydtfhllmplyacrswrgrataregqtlawvraerlreypmp
padlplipilqdwl
Sequence, based on observed residues (ATOM records): (download)
>d3r03b_ d.113.1.0 (B:) automated matches {Rhodospirillum rubrum [TaxId: 269796]}
lglpillvtaaalidpdgrvllaqrppglwefpggklepgetpeaalvrelaeelgvdtr
asclaplafashsydtfhllmplyacrswrgrataregqtlawvraerlreypmppadlp
lipilqdwl
SCOPe Domain Coordinates for d3r03b_:
Click to download the PDB-style file with coordinates for d3r03b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3r03b_:
- d3r03b_ first appeared in SCOPe 2.01
- d3r03b_ appears in SCOPe 2.07
View in 3D
