Lineage for d3qxta_ (3qxt A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (18 species)
not a true protein
Species Llama (Lama glama) [TaxId:9844] [187485] (93 PDB entries) 
Domain d3qxta_: 3qxt A: [184683]
automated match to d1ol0a_
complexed with mtx, na
Details for d3qxta_
PDB Entry: 3qxt (more details), 1.7 Å
PDB Description: Structure of an Anti-Methotrexate CDR1-3 Graft VHH Antibody in Complex with Methotrexate
PDB Compounds: (A:) Anti-Methotrexate CDR1-3 Graft VHHSCOPe Domain Sequences for d3qxta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qxta_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrltty
gdsvkgrftisrdkgkntvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqv
tvss
SCOPe Domain Coordinates for d3qxta_:
Click to download the PDB-style file with coordinates for d3qxta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3qxta_:
- d3qxta_ first appeared in SCOPe 2.01
- d3qxta_ appears in SCOPe 2.04
- d3qxta_ appears in SCOPe 2.06
- d3qxta_ appears in the current release, SCOPe 2.08
View in 3D
