Lineage for d3qu4b_ (3qu4 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920326Species Bacteroides thetaiotaomicron [TaxId:818] [189385] (21 PDB entries)
  8. 2920360Domain d3qu4b_: 3qu4 B: [233350]
    Other proteins in same PDB: d3qu4d2, d3qu4e2
    automated match to d3qypb_
    complexed with act, cl, mg; mutant

Details for d3qu4b_

PDB Entry: 3qu4 (more details), 2.1 Å

PDB Description: crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13ala mutant
PDB Compounds: (B:) inorganic pyrophosphatase

SCOPe Domain Sequences for d3qu4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qu4b_ c.108.1.0 (B:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
rkklkavlfdmagvlfnsmpyhseawhqvmkthgldlsreeaymhegrtgastinivfqr
elgkeatqeeiesiyheksilfnsypeaermpgawellqkvksegltpmvvtgsgqlsll
erlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgglkadeavvienaplgveagh
kagiftiavntgpldgqvlldagadllfpsmqtlcdswdtim

SCOPe Domain Coordinates for d3qu4b_:

Click to download the PDB-style file with coordinates for d3qu4b_.
(The format of our PDB-style files is described here.)

Timeline for d3qu4b_: