Lineage for d3qrjb_ (3qrj B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
members organized in the groups and subfamiles specified by the comments
Protein automated matches [190091] (12 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [188447] (553 PDB entries) 
Domain d3qrjb_: 3qrj B: [196348]
automated match to d2gqga_
complexed with 919; mutant
Details for d3qrjb_
PDB Entry: 3qrj (more details), 1.82 Å
PDB Description: The crystal structure of human abl1 kinase domain T315I mutant in complex with DCC-2036
PDB Compounds: (B:) Tyrosine-protein kinase ABL1SCOPe Domain Sequences for d3qrjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qrjb_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmke
ikhpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevnavvllymatqissame
ylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesla
ynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelm
racwqwnpsdrpsfaeihqafetmf
SCOPe Domain Coordinates for d3qrjb_:
Click to download the PDB-style file with coordinates for d3qrjb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3qrjb_:
- d3qrjb_ first appeared in SCOPe 2.02
- d3qrjb_ appears in SCOPe 2.04
- d3qrjb_ is called d3qrjb1 in SCOPe 2.06
- d3qrjb_ appears in the current release, SCOPe 2.08, called d3qrjb1
View in 3D
