Lineage for d3qjsb2 (3qjs B:37-168)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strandsSuperfamily b.6.1: Cupredoxins [49503] (8 families) 
contains copper-binding site
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) Protein Cytochrome c oxidase [49544] (4 species) Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (30 PDB entries) 
Domain d3qjsb2: 3qjs B:37-168 [233334]
Other proteins in same PDB: d3qjsa_, d3qjsb1, d3qjsc_
automated match to d2qpeb1
complexed with cmo, cu1, cua, has, hem
Details for d3qjsb2
PDB Entry: 3qjs (more details), 2.8 Å
PDB Description: the structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus
PDB Compounds: (B:) Cytochrome c oxidase subunit 2SCOPe Domain Sequences for d3qjsb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qjsb2 b.6.1.2 (B:37-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
lathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpie
vpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglg
hqnmfgtivvke
SCOPe Domain Coordinates for d3qjsb2:
Click to download the PDB-style file with coordinates for d3qjsb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3qjsb2:
- d3qjsb2 first appeared in SCOPe 2.03
- d3qjsb2 appears in SCOPe 2.04
- d3qjsb2 appears in SCOPe 2.06
- d3qjsb2 appears in the current release, SCOPe 2.08
View in 3D
