| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) ![]() |
| Family f.17.2.0: automated matches [227239] (1 protein) not a true family |
| Protein automated matches [226999] (2 species) not a true protein |
| Species Thermus thermophilus HB8 [TaxId:300852] [225642] (8 PDB entries) |
| Domain d3qjsb1: 3qjs B:3-36 [233333] Other proteins in same PDB: d3qjsa_, d3qjsb2, d3qjsc_ automated match to d2qpdb2 complexed with cmo, cu1, cua, has, hem |
PDB Entry: 3qjs (more details), 2.8 Å
SCOPe Domain Sequences for d3qjsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qjsb1 f.17.2.0 (B:3-36) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dqhkahkailayekgwlafslamlfvfialiayt
Timeline for d3qjsb1: