Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
Protein automated matches [190230] (16 species) not a true protein |
Species Yellow mealworm (Tenebrio molitor) [TaxId:7067] [189891] (2 PDB entries) |
Domain d3qj3a_: 3qj3 A: [184410] automated match to d7pcka_ complexed with act |
PDB Entry: 3qj3 (more details), 1.85 Å
SCOPe Domain Sequences for d3qj3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qj3a_ d.3.1.0 (A:) automated matches {Yellow mealworm (Tenebrio molitor) [TaxId: 7067]} lpstfvaekwenfkttyarsyvnakeetfrkqifqkkletfeehnekyrqglvsytlgvn lftdmtpeemkaythglimpadlhkngipiktredlglnasvrypasfdwrdqgmvspvk nqgscgsswafsstgaiesqmkiangagydssvseqqlvdcvpnalgcsggwmndaftyv aqnggidsegaypyemadgnchydpnqvaarlsgyvylsgpdenmladmvatkgpvavaf daddpfgsysggvyynptcetnkfthavlivgygnengqdywlvknswgdgwgldgyfki arnannhcgiagvasvptl
Timeline for d3qj3a_: