Lineage for d3q9za_ (3q9z A:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
members organized in the groups and subfamiles specified by the commentsProtein Protein kinase CK2, alpha subunit [56142] (3 species)
CMGC group; CK2 subfamily; serine/threonine kinaseSpecies Human (Homo sapiens) [TaxId:9606] [75559] (91 PDB entries) 
Domain d3q9za_: 3q9z A: [184302]
automated match to d1jwha_
complexed with edo, na, so4, txq
Details for d3q9za_
PDB Entry: 3q9z (more details), 2.2 Å
PDB Description: Crystal structure of human CK2 alpha in complex with Quinalizarin at pH 6.5
PDB Compounds: (A:) Casein kinase II subunit alphaSCOPe Domain Sequences for d3q9za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q9za_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
dkllrydhqsrltareamehpyfytvvkdqar
SCOPe Domain Coordinates for d3q9za_:
Click to download the PDB-style file with coordinates for d3q9za_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3q9za_:
- d3q9za_ first appeared in SCOPe 2.01
- d3q9za_ appears in SCOPe 2.05
- d3q9za_ appears in SCOPe 2.07
- d3q9za_ appears in the current release, SCOPe 2.08
View in 3D
