Lineage for d3q90b_ (3q90 B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.17: Cystatin-like [54402] (7 superfamilies)
Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheetSuperfamily d.17.4: NTF2-like [54427] (31 families) 
has a beta-alpha(2)-beta insertion after the main helix
Family d.17.4.0: automated matches [191337] (1 protein)
not a true familyProtein automated matches [190205] (21 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [189642] (3 PDB entries) 
Domain d3q90b_: 3q90 B: [184279]
automated match to d1zo2a1
Details for d3q90b_
PDB Entry: 3q90 (more details), 1.7 Å
PDB Description: Crystal structure of the NTF2 domain of Ras GTPase-activating protein-binding protein 1
PDB Compounds: (B:) Ras GTPase-activating protein-binding protein 1SCOPe Domain Sequences for d3q90b_:
Sequence, based on SEQRES records: (download)
>d3q90b_ d.17.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smvmekpspllvgrefvrqyytllnqapdmlhrfygknssyvhggldsngkpadavygqk
eihrkvmsqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegs
vankfyvhndifryqdevfg
Sequence, based on observed residues (ATOM records): (download)
>d3q90b_ d.17.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smvmekpspllvgrefvrqyytllnqapdmlhrfygknssyvhggldpadavygqkeihr
kvmsqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapefyvhnd
ifryqdevfg
SCOPe Domain Coordinates for d3q90b_:
Click to download the PDB-style file with coordinates for d3q90b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3q90b_:
- d3q90b_ first appeared in SCOPe 2.01
- d3q90b_ appears in SCOPe 2.04
- d3q90b_ is called d3q90b1 in SCOPe 2.06
- d3q90b_ appears in the current release, SCOPe 2.08, called d3q90b1
View in 3D
