Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein automated matches [190149] (14 species) not a true protein |
Species Coxiella burnetii [TaxId:360115] [189606] (1 PDB entry) |
Domain d3q7hc_: 3q7h C: [184246] automated match to d1tyfa_ complexed with ca, peg |
PDB Entry: 3q7h (more details), 2.5 Å
SCOPe Domain Sequences for d3q7hc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q7hc_ c.14.1.1 (C:) automated matches {Coxiella burnetii [TaxId: 360115]} vpmvveqtsrgeraydiysrllkdrviflvgqvedhmanlaiaqmlflesenpnkdinly inspggavtsamaiydtmqfvkpdvrtlcigqaasagalllaggakgkrhclphssvmih qvlggyqgqgtdiqihakqtqrvsdqlnqilakhtgkdiervekdtnrdyfltpeeavey glidsifkerp
Timeline for d3q7hc_: