Lineage for d3q0za_ (3q0z A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2220074Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2220075Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2220913Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 protein domains)
  6. 2220921Protein Viral RNA polymerase [56695] (18 species)
  7. 2221010Species Hepatitis C virus [TaxId:11103] [56697] (72 PDB entries)
  8. 2221085Domain d3q0za_: 3q0z A: [184133]
    automated match to d1nb4a_
    protein/RNA complex; complexed with 23e, so4

Details for d3q0za_

PDB Entry: 3q0z (more details), 2.29 Å

PDB Description: Crystal structure of the hepatitis C virus NS5B RNA-dependent RNA polymerase complex with (2E)-3-(4-{[(1-{[(13-cyclohexyl-6-oxo-6,7-dihydro-5h-indolo[1,2-d][1,4]benzodiazepin-10-yl)carbonyl]amino}cyclopentyl)carbonyl]amino}phenyl)prop-2-enoic acid
PDB Compounds: (A:) RNA-directed RNA polymerase

SCOPe Domain Sequences for d3q0za_:

Sequence, based on SEQRES records: (download)

>d3q0za_ e.8.1.4 (A:) Viral RNA polymerase {Hepatitis C virus [TaxId: 11103]}
smsytwtgalitpcaaeetklpinalsnsllrhhnlvyattsrsaslrqkkvtfdrlqvl
ddhyrdvlkemkakastvkakllsveeackltpphsarskfgygakdvrnlsskavnhir
svwkdlledtetpidttimaknevfcvqpekggrkparlivfpdlgvrvcekmalydvvs
tlpqavmgssygfqyspgqrveflvnawkakkcpmgfaydtrcfdstvtendirveesiy
qccdlapearqairslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylkaa
aacraaklqdctmlvcgddlvvicesagtqedeaslrafteamtrysappgdppkpeydl
elitscssnvsvahdasgkrvyyltrdpttplaraawetarhtpvnswlgniimyaptlw
armilmthffsillaqeqlekaldcqiygacysiepldlpqiiqrlhglsafslhsyspg
einrvasclrklgvpplrvwrhrarsvrarllsqggraatcgkylfnwavrtklkltpip
aasqldlsswfvagysggdiyhslsrarprwfm

Sequence, based on observed residues (ATOM records): (download)

>d3q0za_ e.8.1.4 (A:) Viral RNA polymerase {Hepatitis C virus [TaxId: 11103]}
smsytwtgalitpcvyattsrsaslrqkkvtfdrlqvlddhyrdvlkemkakastvkakl
lsveeackltpphsarskfgygakdvrnlsskavnhirsvwkdlledtetpidttimakn
evfcvqpekggrkparlivfpdlgvrvcekmalydvvstlpqavmgssygfqyspgqrve
flvnawkakkcpmgfaydtrcfdstvtendirveesiyqccdlapearqairslterlyi
ggpltnskgqncgyrrcrasgvlttscgntltcylkaaaacraaklqdctmlvcgddlvv
icesagtqedeaslrafteamtrysappgdppkpeydlelitscssnvsvahdasgkrvy
yltrdpttplaraawetarhtpvnswlgniimyaptlwarmilmthffsillaqeqleka
ldcqiygacysiepldlpqiiqrlhglsafslhsyspgeinrvasclrklgvpplrvwrh
rarsvrarllsqggraatcgkylfnwavrtklkltpipaasqldlsswfvagysggdiyh
slsrarprwfm

SCOPe Domain Coordinates for d3q0za_:

Click to download the PDB-style file with coordinates for d3q0za_.
(The format of our PDB-style files is described here.)

Timeline for d3q0za_: