Class a: All alpha proteins [46456] (286 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein automated matches [190435] (9 species) not a true protein |
Species Escherichia coli [TaxId:511145] [189613] (7 PDB entries) |
Domain d3pvtc_: 3pvt C: [184018] automated match to d1otka_ complexed with 3hc, gol |
PDB Entry: 3pvt (more details), 2.03 Å
SCOPe Domain Sequences for d3pvtc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pvtc_ a.25.1.2 (C:) automated matches {Escherichia coli [TaxId: 511145]} snqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaela gegdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqla aisakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidials eegiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqylq rvlpgqqw
Timeline for d3pvtc_: