Lineage for d3peya2 (3pey A:287-481)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871683Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225477] (15 PDB entries)
  8. 2871685Domain d3peya2: 3pey A:287-481 [265180]
    automated match to d3rrma2
    protein/RNA complex; complexed with adp, bef, gol, mg, no3

Details for d3peya2

PDB Entry: 3pey (more details), 1.4 Å

PDB Description: s. cerevisiae dbp5 bound to rna and adp bef3
PDB Compounds: (A:) ATP-dependent RNA helicase DBP5

SCOPe Domain Sequences for d3peya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3peya2 c.37.1.0 (A:287-481) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pnantlelqtnevnvdaikqlymdckneadkfdvltelyglmtigssiifvatkktanvl
ygklkseghevsilhgdlqtqerdrliddfregrskvlittnvlargidiptvsmvvnyd
lptlangqadpatyihrigrtgrfgrkgvaisfvhdknsfnilsaiqkyfgdiemtrvpt
ddwdevekivkkvlk

SCOPe Domain Coordinates for d3peya2:

Click to download the PDB-style file with coordinates for d3peya2.
(The format of our PDB-style files is described here.)

Timeline for d3peya2:

2871685
d3peya2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3peya1