SCOPe 2.06: Domain d3pefa2: 3pef A:163-287

Lineage for d3pefa2 (3pef A:163-287)

Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds)

Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
Family a.100.1.0: automated matches [227147] (1 protein)
not a true family
Protein automated matches [226851] (35 species)
not a true protein
Species Geobacter metallireducens [TaxId:28232] [233234] (1 PDB entry)
Domain d3pefa2: 3pef A:163-287 [233235]
Other proteins in same PDB: d3pefa1, d3pefb1, d3pefc1, d3pefd1, d3pefe1, d3peff1, d3pefg1, d3pefh1
automated match to d1vpda1
complexed with edo, gol, nap, peg

Details for d3pefa2

PDB Entry: 3pef (more details), 2.07 Å

PDB Description: crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+

PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, NAD-binding

SCOPe Domain Sequences for d3pefa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pefa2 a.100.1.0 (A:163-287) automated matches {Geobacter metallireducens [TaxId: 28232]}
dvgkgaemklvvnmvmggmmacfceglalgekaglatdaildvigagamanpmfalkggl
irdrnfapafplkhmqkdlrlavalgdrvgqplvasaaanelfkgaraagfgdedfsaif
ktyer

SCOPe Domain Coordinates for d3pefa2:

Click to download the PDB-style file with coordinates for d3pefa2.
(The format of our PDB-style files is described here.)

Timeline for d3pefa2: