SCOPe 2.05: Domain d3pduc1: 3pdu C:2-163

Lineage for d3pduc1 (3pdu C:2-163)

Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)
Family c.2.1.0: automated matches [191313] (1 protein)
not a true family
Protein automated matches [190069] (203 species)
not a true protein
Species Geobacter sulfurreducens [TaxId:35554] [233218] (1 PDB entry)
Domain d3pduc1: 3pdu C:2-163 [233219]
Other proteins in same PDB: d3pdua2, d3pdub2, d3pduc2, d3pdud2, d3pdue2, d3pduf2, d3pdug2, d3pduh2
automated match to d2i9pa1
complexed with gol, nap

Details for d3pduc1

PDB Entry: 3pdu (more details), 1.89 Å

PDB Description: crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+

PDB Compounds: (C:) 3-hydroxyisobutyrate dehydrogenase family protein

SCOPe Domain Sequences for d3pduc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pduc1 c.2.1.0 (C:2-163) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
ttygflglgimggpmaanlvragfdvtvwnrnpakcaplvalgarqasspaevcaacdit
iamladpaaarevcfgangvlegigggrgyidmstvddetstaigaavtarggrfleapv
sgtkkpaedgtliilaagdqslftdagpafaalgkkclhlge

SCOPe Domain Coordinates for d3pduc1:

Click to download the PDB-style file with coordinates for d3pduc1.
(The format of our PDB-style files is described here.)

Timeline for d3pduc1: