SCOPe 2.08: Domain d3p9id1: 3p9i D:10-116

Lineage for d3p9id1 (3p9i D:10-116)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
contains a small beta-sheet (wing)
Family a.4.5.0: automated matches [191329] (1 protein)
not a true family
Protein automated matches [190154] (92 species)
not a true protein
Species Lolium perenne [TaxId:4522] [226053] (3 PDB entries)
Domain d3p9id1: 3p9i D:10-116 [214720]
Other proteins in same PDB: d3p9ia2, d3p9ib2, d3p9ic2, d3p9id2
automated match to d1kyze1
complexed with bme, sah, sny

Details for d3p9id1

PDB Entry: 3p9i (more details), 1.85 Å

PDB Description: crystal structure of perennial ryegrass lpomt1 complexed with s- adenosyl-l-homocysteine and sinapaldehyde

PDB Compounds: (D:) Caffeic acid O-methyltransferase

SCOPe Domain Sequences for d3p9id1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p9id1 a.4.5.0 (D:10-116) automated matches {Lolium perenne [TaxId: 4522]}
asadedacmfalqlasssvlpmtlknaielglleilvaaggksltptevaaklpsaanpe
apdmvdrilrllasynvvtclveegkdgrlsrsygaapvckfltpne

SCOPe Domain Coordinates for d3p9id1:

Click to download the PDB-style file with coordinates for d3p9id1.
(The format of our PDB-style files is described here.)

Timeline for d3p9id1: