Lineage for d3p95a_ (3p95 A:)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) Protein Trypsin(ogen) [50515] (9 species) 
Species Human (Homo sapiens), trypsin IV (brain isoform) [TaxId:9606] [69283] (7 PDB entries) 
Domain d3p95a_: 3p95 A: [183599]
Other proteins in same PDB: d3p95e_
automated match to d1h4wa_
complexed with ca
Details for d3p95a_
PDB Entry: 3p95 (more details), 1.3 Å
PDB Description: Human mesotrypsin complexed with bovine pancreatic trypsin inhibitor variant (BPTI-K15R/R17D)
PDB Compounds: (A:) PRSS3 proteinSCOPe Domain Sequences for d3p95a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p95a_ b.47.1.2 (A:) Trypsin(ogen) {Human (Homo sapiens), trypsin IV (brain isoform) [TaxId: 9606]}
ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
SCOPe Domain Coordinates for d3p95a_:
Click to download the PDB-style file with coordinates for d3p95a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3p95a_:
- d3p95a_ first appeared in SCOPe 2.01
- d3p95a_ appears in SCOPe 2.02
- d3p95a_ appears in SCOPe 2.04
- d3p95a_ appears in the current release, SCOPe 2.08
View in 3D
