Lineage for d3p1fa_ (3p1f A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.29: Bromodomain-like [47363] (15 superfamilies)
4 helices; bundle; minor mirror variant of up-and-down topologySuperfamily a.29.2: Bromodomain [47370] (2 families) 
Family a.29.2.1: Bromodomain [47371] (5 proteins) Protein automated matches [190366] (1 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187201] (31 PDB entries) 
Domain d3p1fa_: 3p1f A: [183451]
automated match to d1jspb_
complexed with 3pf, edo, k
Details for d3p1fa_
PDB Entry: 3p1f (more details), 1.63 Å
PDB Description: crystal structure of the bromodomain of human crebbp in complex with a hydroquinazolin ligand
PDB Compounds: (A:) creb-binding proteinSCOPe Domain Sequences for d3p1fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p1fa_ a.29.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlsti
krkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg
SCOPe Domain Coordinates for d3p1fa_:
Click to download the PDB-style file with coordinates for d3p1fa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3p1fa_:
- d3p1fa_ first appeared in SCOPe 2.01
- d3p1fa_ appears in SCOPe 2.04
- d3p1fa_ is called d3p1fa1 in SCOPe 2.06
- d3p1fa_ appears in the current release, SCOPe 2.08, called d3p1fa1
View in 3D
