Lineage for d3p0ya1 (3p0y A:310-480)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851793Family c.10.2.5: L domain [52071] (6 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 2851794Protein EGF receptor extracellular domain [82326] (1 species)
  7. 2851795Species Human (Homo sapiens) [TaxId:9606] [82327] (7 PDB entries)
  8. 2851796Domain d3p0ya1: 3p0y A:310-480 [233152]
    Other proteins in same PDB: d3p0ya2, d3p0yh_, d3p0yl1, d3p0yl2
    automated match to d3b2ua1
    complexed with gol

Details for d3p0ya1

PDB Entry: 3p0y (more details), 1.8 Å

PDB Description: anti-egfr/her3 fab dl11 in complex with domain iii of egfr extracellular region
PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d3p0ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p0ya1 c.10.2.5 (A:310-480) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
rkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeld
ilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrsl
keisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq

SCOPe Domain Coordinates for d3p0ya1:

Click to download the PDB-style file with coordinates for d3p0ya1.
(The format of our PDB-style files is described here.)

Timeline for d3p0ya1:

2851796
d3p0ya1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3p0ya2