Lineage for d3ovub_ (3ovu B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1771461Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 1771462Family b.1.28.1: NEAT domain [158912] (4 proteins)
    Pfam PF05031; iron transport-associated domain
  6. 1771485Protein automated matches [191246] (3 species)
    not a true protein
  7. 1771503Species Staphylococcus aureus [TaxId:282459] [226200] (2 PDB entries)
  8. 1771504Domain d3ovub_: 3ovu B: [200163]
    Other proteins in same PDB: d3ovua_, d3ovuc_
    automated match to d2h3ka1
    complexed with hem

Details for d3ovub_

PDB Entry: 3ovu (more details), 2.83 Å

PDB Description: Crystal Structure of Human Alpha-Haemoglobin Complexed with AHSP and the First NEAT Domain of IsdH from Staphylococcus aureus
PDB Compounds: (B:) Iron-regulated surface determinant protein H

SCOPe Domain Sequences for d3ovub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ovub_ b.1.28.1 (B:) automated matches {Staphylococcus aureus [TaxId: 282459]}
hmadeslkdaikdpalenkehdigpreqvnfqlldknnetqyyhffsikdpadvyytkkk
aeveldintastwkkfevyennqklpvrlvsyspvpedhayirfpvsdgtqelkivsstq
iddgeetnydytklvfakpiyndp

SCOPe Domain Coordinates for d3ovub_:

Click to download the PDB-style file with coordinates for d3ovub_.
(The format of our PDB-style files is described here.)

Timeline for d3ovub_: