Lineage for d3otwf_ (3otw F:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590100Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1590710Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 1590711Protein automated matches [190459] (36 species)
    not a true protein
  7. 1590803Species Helicobacter pylori [TaxId:85962] [193641] (2 PDB entries)
  8. 1590810Domain d3otwf_: 3otw F: [193642]
    automated match to d1gn8a_
    complexed with coa, so4

Details for d3otwf_

PDB Entry: 3otw (more details), 1.8 Å

PDB Description: Structural and Functional Studies of Helicobacter pylori Wild-Type and Mutated Proteins Phosphopantetheine adenylyltransferase
PDB Compounds: (F:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3otwf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3otwf_ c.26.1.0 (F:) automated matches {Helicobacter pylori [TaxId: 85962]}
mqkigiypgtfdpvtnghidiihrsselfeklivavahssaknpmfslderlkmiqlatk
sfknvecvafegllanlakeyhckvlvrglrvvsdfeyelqmgyankslnheletlyfmp
tlqnafisssivrsiiahkgdashlvpkeiyplisk

SCOPe Domain Coordinates for d3otwf_:

Click to download the PDB-style file with coordinates for d3otwf_.
(The format of our PDB-style files is described here.)

Timeline for d3otwf_: