Lineage for d3osub_ (3osu B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.0: automated matches [191313] (1 protein)
not a true familyProtein automated matches [190069] (203 species)
not a true protein
Species Staphylococcus aureus [TaxId:158878] [189493] (1 PDB entry) 
Domain d3osub_: 3osu B: [191803]
automated match to d3osua_
complexed with mg, peg, po4
Details for d3osub_
PDB Entry: 3osu (more details), 1.9 Å
PDB Description: crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] reductaseSCOPe Domain Sequences for d3osub_:
Sequence, based on SEQRES records: (download)
>d3osub_ c.2.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]}
ksalvtgasrgigrsialqlaeegynvavnyagskekaeavveeikakgvdsfaiqanva
dadevkamikevvsqfgsldvlvnnagitrdnllmrmkeqewddvidtnlkgvfnciqka
tpqmlrqrsgaiinlssvvgavgnpgqanyvatkagvigltksaarelasrgitvnavap
gfivsdmtdalsdelkeqmltqiplarfgqdtdiantvaflasdkakyitgqtihvnggm
ym
Sequence, based on observed residues (ATOM records): (download)
>d3osub_ c.2.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]}
ksalvtgasrgigrsialqlaeegynvavnyagskekaeavveeikakgvdsfaiqanva
dadevkamikevvsqfgsldvlvnnagitrdnllmrmkeqewddvidtnlkgvfnciqka
tpqmlrqrsgaiinlssvvgavgnpgqanyvatkagvigltksaarelasrgitvnavap
gfivsdmlsdelkeqmltqiplarfgqdtdiantvaflasdkakyitgqtihvnggmym
SCOPe Domain Coordinates for d3osub_:
Click to download the PDB-style file with coordinates for d3osub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3osub_:
- d3osub_ first appeared in SCOPe 2.02
- d3osub_ appears in SCOPe 2.04
- d3osub_ appears in SCOPe 2.06
- d3osub_ appears in the current release, SCOPe 2.08
View in 3D
