Lineage for d3osga2 (3osg A:97-150)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1721270Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1721271Protein automated matches [190674] (16 species)
    not a true protein
  7. 1721364Species Trichomonas vaginalis [TaxId:5722] [233124] (4 PDB entries)
  8. 1721366Domain d3osga2: 3osg A:97-150 [233130]
    automated match to d1gv2a2
    protein/DNA complex

Details for d3osga2

PDB Entry: 3osg (more details), 2 Å

PDB Description: The structure of protozoan parasite Trichomonas vaginalis Myb2 in complex with MRE-1-12 DNA
PDB Compounds: (A:) myb21

SCOPe Domain Sequences for d3osga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3osga2 a.4.1.0 (A:97-150) automated matches {Trichomonas vaginalis [TaxId: 5722]}
sishtpwtaeedallvqkiqeygrqwaiiakffpgrtdihiknrwvtisnklgi

SCOPe Domain Coordinates for d3osga2:

Click to download the PDB-style file with coordinates for d3osga2.
(The format of our PDB-style files is described here.)

Timeline for d3osga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3osga1