Lineage for d3okka2 (3okk A:108-215)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517994Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)
  8. 1518079Domain d3okka2: 3okk A:108-215 [214412]
    Other proteins in same PDB: d3okka1
    automated match to d1eapa2
    complexed with zn

Details for d3okka2

PDB Entry: 3okk (more details), 1.95 Å

PDB Description: crystal structure of s25-39 in complex with kdo(2.4)kdo
PDB Compounds: (A:) S25-39 Fab (IgG1k) light chain

SCOPe Domain Sequences for d3okka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3okka2 b.1.1.2 (A:108-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserangvlnswtdqd
skdstysmtstltltkdeyerhnsytceashktstspivksfnrnecx

SCOPe Domain Coordinates for d3okka2:

Click to download the PDB-style file with coordinates for d3okka2.
(The format of our PDB-style files is described here.)

Timeline for d3okka2: