Lineage for d3ojga_ (3ojg A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2834067Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2834068Protein automated matches [190150] (36 species)
    not a true protein
  7. 2834155Species Geobacillus kaustophilus [TaxId:1462] [189526] (16 PDB entries)
  8. 2834172Domain d3ojga_: 3ojg A: [183070]
    automated match to d2d2ga1
    complexed with fe, hl4, zn

Details for d3ojga_

PDB Entry: 3ojg (more details), 1.6 Å

PDB Description: structure of an inactive lactonase from geobacillus kaustophilus with bound n-butyryl-dl-homoserine lactone
PDB Compounds: (A:) phosphotriesterase

SCOPe Domain Sequences for d3ojga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ojga_ c.1.9.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
emvetvcgpvpveqlgktlihehflfgypgfqgdvtrgtfredeslrvaveaaekmkrhg
iqtvvdptpndcgrnpaflrrvaeetglniicatgyyyegegappyfqfrrllgtaeddi
ydmfmaeltegiadtgikagviklasskgriteyekmffraaaraqketgaviithtqeg
tmgpeqaayllehgadpkkivighmcgntdpdyhrktlaygvyiafdrfgiqgmvgaptd
eervrtllallrdgyekqimlshntvnvwlgrpftlpepfaemmknwhvehlfvniipal
knegirdevleqmfignpaalfs

SCOPe Domain Coordinates for d3ojga_:

Click to download the PDB-style file with coordinates for d3ojga_.
(The format of our PDB-style files is described here.)

Timeline for d3ojga_: